Low

TEXAS INSTRUMENTS  TPS70151PWPG4  SPANNUNGSREGLER DUAL-O/P,HTSSOP20

TEXAS INSTRUMENTS TPS70151PWPG4
Technical Data Sheet (10.13KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The TPS70151PWPG4 is a dual-output low-dropout (LDO) Voltage Regulator with power-up sequencing for split-voltage systems. This device is designed to provide a complete power management solution for the TMS320 DSP family, processor power, ASIC, FPGA and digital applications where dual output voltage regulator is required. Easy programmability of the sequencing function makes the device ideal for any TMS320 DSP applications with power sequencing requirements. Differentiated features, such as accuracy, fast transient response, SVS supervisory circuit, manual reset inputs and an enable function, provide a complete system solution. This voltage regulator offers very low-dropout voltage and dual outputs with power-up sequence control, which is designed primarily for DSP applications. This device has extremely low noise output performance without using any added filter bypass capacitors and is designed to have a fast transient response and be stable with 10µF low ESR capacitors.
  • Dual output voltages for split-supply
  • Quick output capacitor discharge
  • Two manual reset inputs
  • Undervoltage lockout
  • Thermal shutdown protection
  • Open drain power good
  • Open drain power-ON reset with 120ms delay
  • Ultra low 190µA typical quiescent current
  • 1µA Input current during standby
  • 65µVRMS Without bypass capacitor low noise
  • 2% Accuracy over load and temperature
  • Green product and no Sb/Br

Produktspezifikationen

Eingangsspannung, max.:
6V
Eingangsspannung, min.:
2.7V
Anzahl der Ausgänge:
2 Ausgänge
Reglerausgang:
Fest
Bauform:
HTSSOP
Anzahl der Pins:
20Pin(s)
Ausgangsstrom - Ausgang 1:
500mA
Ausgangsstrom - Ausgang 2:
250mA
Ausgangsspannung - Ausgang 1:
3.3V
Ausgangsspannung - Ausgang 2:
1.8V
Dropout-Spannung Vdo:
170mV
Verpackung:
Stückweise
Produktpalette:
-
Qualifizierungsstandard der Automobilindustrie:
-
MSL:
MSL 2 - 1 Jahr
Anzahl der Ausgänge:
2
SVHC:
No SVHC (15-Jun-2015)

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • Power-Management;
  • Unterhaltungselektronik;
  • Automatisierung & Prozesssteuerung

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
MSL 2 - 1 Jahr
Herkunftsland:
Taiwan

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85423990
Gewicht (kg):
.000253

Alternativen

IC, DUAL LDO REG, 1.8V/3.3V, 20-HTSSOP

TEXAS INSTRUMENTS

Lieferung wird erwartet (Rückstandsbearbeitung nach den angezeigten Vorlaufzeiten möglich)

Preiseinheit: Stück

1+ CHF 4.68 10+ CHF 4.14 25+ CHF 3.87 50+ CHF 3.67 Mehr…

Kaufen

Ähnliche Produkte