Low

ON SEMICONDUCTOR  NCP45560IMNTWG-H  Leistungsschalter, Active-High, 1 Ausgang, 13.5V, 24A, DFN-12

ON SEMICONDUCTOR NCP45560IMNTWG-H
Technical Data Sheet (165.79KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The NCP45560IMNTWG-H is a Load Switch provides a component and area-reducing solution for efficient power domain switching with inrush current limit via soft-start. In addition to integrated control functionality with ultra low on-resistance, this device offers system safeguards and monitoring via fault protection and power good signalling. This cost effective solution is ideal for power management and hot-swap applications requiring low power consumption in a small footprint.
  • Advanced controller with charge pump
  • Integrated N-Channel MOSFET
  • Soft-start via slew rate control (adjustable)
  • Low standby current
  • Quick output discharge function (adjustable)
  • No external components required
  • Power good signalling

Produktspezifikationen

Leistungsschaltertyp:
-
Eingangsspannung:
13.5V
Strombegrenzung:
24A
Durchlasswiderstand:
0.0032ohm
Bauform:
DFN
Anzahl der Pins:
12Pin(s)
Überhitzungsschutz:
Ja
Polarität der Eingänge On / Enable:
Aktiv-High
Anzahl der Ausgänge:
1Ausgänge
Betriebstemperatur, min.:
-40°C
Betriebstemperatur, max.:
85°C
Verpackung:
Gurtabschnitt
Produktpalette:
-
Qualifizierungsstandard der Automobilindustrie:
-
MSL:
MSL 3 - 168 Stunden
SVHC:
No SVHC (17-Dec-2015)

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • Tragbare Geräte;
  • Computer & Computerperipheriegeräte;
  • Kommunikation & Netzwerke;
  • Industrie;
  • Medizinelektronik

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
MSL 3 - 168 Stunden
Herkunftsland:
China

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85423990
Gewicht (kg):
.000189

Ähnliche Produkte