Low

BI TECHNOLOGIES / TT ELECTRONICS  SSN16A3300JSLF  Widerstandsnetzwerk, fester Wert, 330 ohm, 100 V, 8 Element(e), Isoliert, SOIC, 100 mW

BI TECHNOLOGIES / TT ELECTRONICS SSN16A3300JSLF
Technical Data Sheet (161.84KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The SSN series thin film nichrome Network Resistor with matte tin-plated copper alloy lead, silicon substrate and moulded epoxy body. It offers passivation coating provides protection in humid environments.
  • Isolated and bussed circuit
  • -55 to 125°C Operating temperature range

Produktspezifikationen

Widerstand:
330ohm
Nennspannung:
100V
Anzahl der Elemente:
8Element(e)
Netzwerkelement:
Isoliert
Bauform:
SOIC
Nennleistung pro Element:
100mW
Widerstandstoleranz:
± 5%
Produktpalette:
-
Temperaturkoeffizient:
± 100ppm/°C
Anzahl der Pins:
16Pin(s)
Qualifizierungsstandard der Automobilindustrie:
-
MSL:
-
SVHC:
No SVHC (20-Jun-2016)

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • Industrie

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
-
Herkunftsland:
Malaysia

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85332100
Gewicht (kg):
.00012

Ähnliche Produkte

Sie können nach Produkten mit einer ähnlichen Funktionalität wie dieser suchen. Wählen Sie einen der folgenden Links aus. Sie gelangen dann auf eine Seite für Produktgruppen, auf der alle Produkte in dieser Kategorie aufgeführt werden, die über dieses bestimmte Attribut verfügen.